![NCBI](https://webharvest.gov/peth04/20041106132338im_/http://www.ncbi.nlm.nih.gov/corehtml/left.GIF) |
Sequin Revision History |
This file lists changes that have been made to the Sequin program. Where appropriate, there are also links to the relevant section of the Sequin help documentation.
Version 5.25--June 18, 2004
- The alignment reader has been updated to allow for the designation of non-IUPAC characters used to indicate gaps, ambiguities, and match (identical) characters in alignment submissions. Details about specifying these characters can be found in the Sequin help
documentation
. If the alignment used for submission is not valid, errors will be reported to the submitter indicating the problem and possible solutions.
- Batch Feature Apply and Batch Feature Edit functions have been added under the Annotate menu. The Batch Feature Apply function allows you to add the same feature across the entire span of each of a set of similar sequences. The Batch Feature Edit function allows you to globaly edit existing features that appear on a set of similar sequences. More details about these options can be found in the Sequin help
documentation
.
Version 4.50--April 28, 2003
- Sequin has been updated to allow for easier submission of sequences to the Third Party Annotation
Database
(TPA)
.
You must indicate during the submission process that the Submission category
is Third Party Annotation. An Assembly Tracking pop-up will allow you to input the primary
accession number(s) from which the Third Party Annotation sequence is derived.
- The alignment view in the Record Viewer has been updated to display the nucleotide sequences contained within the alignment rather than a graphical view of the alignment. Differences between the sequences can be easily identified by adjusting the target sequence.
Version 4.00--April 26, 2002
- A number of improvements have been made to increase the speed and overall performance of the program.
- The Graphical View has been updated to more accurately display the features presented within the file.
- A variety of minor bugs have been fixed (affecting all platforms).
Version 3.70--May 24, 2001
- The Update Sequence utility has been revised. The new version
is based on an alignment indexing function and offers new update possibilities,
such as 'patching' a corrected fragment of a sequence to the current sequence.
The new function is described in more detail in the
Help documentation.
- Feature Propagation has also been revised to use the alignment
indexing function. This new tool can be found under the Edit menu
of the Record Viewer. Details can be found in the
Help documentation.
Version 3.32--July 12, 2000
- Improved validation of PHRAP quality scores
Version 3.30--May 19, 2000
- A bug in the Update Sequence utility has been fixed. This function can align highly related sequences of any length; aligning less similar sequences will cause Sequin to crash. A different algorithm that will allow alignment of less related sequences will be introduced later this year. Update Sequence is described in more detail in the Help documentation.
- Sequin can read in a simple five-column tab-delimited table of feature locations and qualifiers, along with the DNA sequence and submitter information, and prepare a GenBank submission. Even very long chromosomes (e.g., 20 Mb) can be processed in seconds. The entire process can be automated for multiple chromosomes in a genome with the utility tbl2asn, now packaged with the Sequin download. Detailed instructions are now available.
- Improvements in reading sequences in NEXUS format (for submitting nucleotide alignments)
- Better handling of PHRAP quality scores for HTG submissions
- A variety of minor bugs have been fixed (affecting all platforms).
Version 3.25--March 28, 2000
- Improvements in reading sequences in NEXUS format (for submitting nucleotide alignments)
- Better handling of PHRAP quality scores for HTG submissions
- A variety of minor bugs have been fixed (affecting all platforms).
Version 3.17--February 10, 2000
- A variety of minor bugs have been fixed (affecting all platforms).
Version 3.05--November 5, 1999
- A variety of minor bugs have been fixed (affecting all platforms).
Version 3.00--September 19, 1999
- It is now easier to configure Sequin for network access when you are
behind a firewall. If you use Sequin in its network aware mode, you
can download existing GenBank records into Sequin for easier updating,
screen your sequence for vector or mitochondrial contamination, and
perform PowerBLAST searches. For additional information, see
http://www.ncbi.nlm.nih.gov/Sequin/netaware.html .
- A variety of minor bugs have been fixed (affecting all platforms).
Version 2.90--May 10, 1999
- A variety of minor bugs have been fixed (affecting all platforms).
Version 2.80--January 27, 1999
- Setting up Sequin to communicate over the network is now much easier.
Sequin can function as either a stand-alone or network-aware program.
The stand-alone version is all that is needed to perform most sequence
submissions. In its network aware mode, Sequin can also communicate
with the NCBI to download sequences from Entrez, perform Power-BLAST
searches and Entrez queries, and screen for the presence of vector
sequences or repeat elements.
The Network Configuration program is located under the Misc menu, both
on the initial Welcome to Sequin page and in the record viewer. Most
users can select a "Normal" connection and click on Accept to begin the
configuration. If you are behind a firewall, you may need to contact
your system administrator in order to fill in the Proxy and Port
fields. Users outside the United States or with a bad Internet
connection may need to increase the Timeout, the length of time for
which Sequin will wait for a response from the network.
- Asnload files are no longer included in the Sequin distribution
Due to improvements in NCBI services, Asnload files are no longer
necessary on any platform for recent NCBI software. Therefore, when you download and install the new version of Sequin, the Asnload folder will no longer be present.
Version 2.70--September 14, 1998
- This version is capable of editing complete bacterial chromosomes
or large eukaryotic chromosomal segments in a single record.
The generation of reports (i.e., GenBank and Graphic view) and
validation are now much faster.
- Sequin can now annotate features by reading in a tab-delimited
table. The table specifies the location and type of feature, and
Sequin processes the feature intervals and translates any CDSs. The
table is read in the record viewer (after the sequence has been
imported) using the File-->Open menu. The table must follow a defined
format. The first line starts with >Feature, a space, and then the
Sequence ID of the sequence you are annotating. In the example below,
eIF4E is the Sequence ID. The table is composed of five columns:
start, stop, feature key, qualifier key, and qualifier value. The
columns are separated by tabs. The first row has start, stop, and
feature key. Additional feature intervals just have start and stop.
The qualifiers follow on lines starting with three tabs.
For example, a table which looks like this:
>Feature eIF4E
80 2881 gene
gene eIF4E
201 224 CDS
1550 1920
1986 2085
2317 2404
2466 2629
product eukaryotic initiation factor 4E-II
1402 1458 CDS
1550 1920
1986 2085
2317 2404
2466 2629
product eukaryotic initiation factor 4E-I
note encoded by two messenger RNAs
80 224 mRNA
1550 1920
1986 2085
2317 2404
2466 2881
product eukaryotic initiation factor 4E-II
80 224 mRNA
892 1458
1550 1920
1986 2085
2317 2404
2466 2881
product eukaryotic initiation factor 4E-I
80 224 mRNA
1129 1458
1550 1920
1986 2085
2317 2404
2466 2881
product eukaryotic initiation factor 4E-I
will result in a GenBank flatfile which contains this:
mRNA join(80..224,1129..1458,1550..1920,1986..2085,2317..2404,
2466..2881)
/gene="eIF4E"
/product="eukaryotic initiation factor 4E-I"
mRNA join(80..224,892..1458,1550..1920,1986..2085,2317..2404,
2466..2881)
/gene="eIF4E"
/product="eukaryotic initiation factor 4E-I"
mRNA join(80..224,1550..1920,1986..2085,2317..2404,2466..2881)
/gene="eIF4E"
/product="eukaryotic initiation factor 4E-II"
gene 80..2881
/gene="eIF4E"
CDS join(201..224,1550..1920,1986..2085,2317..2404,2466..2629)
/gene="eIF4E"
/codon_start=1
/product="eukaryotic initiation factor 4E-II"
/translation="MVVLETEKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETG
EPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTV
EDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDN
LWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDAL
RLGRNNSLQYQLHKDTMVKQGSNVKSIYTL"
CDS join(1402..1458,1550..1920,1986..2085,2317..2404,
2466..2629)
/gene="eIF4E"
/note="encoded by two messenger RNAs"
/codon_start=1
/product="eukaryotic initiation factor 4E-I"
/translation="MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKD
VKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWED
MQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVIT
LNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAA
LEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL"
Note that if the gene feature spans the intervals of the CDS and mRNA
features for that gene, you don't need to include gene "qualifiers" in
those features, since they will be picked up by overlap.
Features which are on the complementary strand are indicated by reversing
the interval locations. For example, the table:
>Features dna2
2710 2639 tRNA
note codon recognized: GAA
product tRNA-Glu
anticodon (pos:2675..2677, aa:Glu)
will result in a GenBank flatfile containing:
tRNA complement(2639..2710)
/note="codon recognized: GAA"
/product="tRNA-Glu"
/anticodon=(pos:2675..2677, aa:Glu)
Version 2.60--June 2, 1998
- You can now open a FASTA-formatted DNA sequence file in Sequin
without first creating a Sequin record. On the Welcome to Sequin Form,
click on "Read Existing Record" to read in your sequence and open it in
the record viewer. Or, if you are already viewing a record in Sequin,
choose File-->Open to open a FASTA-formatted DNA sequence. However,
although the sequence will be displayed in Sequin and can be analyzed
with tools such as PowerBLAST, Vector Screen, or ORF Finder, it should
not be submitted, because it does not have the appropriate annotations
or the required contact information to make it a valid submission.
- A variety of minor bugs have been fixed (affecting all platforms).
Version 2.45--March 3, 1998
- Easier sequence annotations
You can now use the Sequence Editor Feature menu, as well as the
main Sequin Annotate menu, to annotate features on the sequence.
The features listed are identical, and the instructions for adding
them are the same, with one exception. If you annotate them in the
Annotate menu, you must provide the nucleotide sequence location of
the feature. However, if you add features from the Sequence
Editor, you do not need to enter the nucleotide coordinates
manually. Simply highlight the sequence which the feature covers,
and the location of the sequence will be automatically entered in
the feature location box.
- New PowerBLAST features
PowerBLAST capabilities have been enhanced. When you do a
PowerBLAST from within Sequin, you can limit a search either for or
against an organism or taxonomic group. Under Organism Filter,
click on "Restrict to" to limit your search to a particular
organism. Or, conversely, click on "Filter against" to search
against all organisms except one. Type the scientific name of the
organism (e.g., Homo Sapiens) or taxonomic group (e.g., Mammalia)
in the "Name" box. After you do a PowerBLAST search, additional
controls will be added to the bottom of the record viewer window.
These controls allow you to retrieve the PowerBLAST hits from
Entrez, and then look for Entrez neighbors. Use the alignment
pop-up to select the type of alignment (search) that was performed.
If multiple blast search types were run in one PowerBLAST search,
this allows you to get one type at a time. Then click on the
Retrieve button to retrieve the records in a document summary
window, where you can view Medline, Protein, Nucleotide, Structure,
and Genome neighbors of the sequence(s). Click on the Refine button
to open a query refinement window in which you can further refine
the PowerBLAST hits by selecting other Entrez terms, such as Author
name to view sequences belonging to a specific author.
- Replacing or updating your sequence
We had previously explained that you can now replace or merge the
sequence in the record with a new sequence without going into the
Sequence Editor. This option is available in the Update Sequence
submenu of the main Sequin Edit menu. In addition to being able
import a sequence in FASTA format (Read FASTA File), import a
sequence record in ASN.1 format (Read Sequence Record), or download
a sequence record from Entrez (Download Accession), you can now
import a sequence from a Sequin PowerBLAST alignment (Selected
Alignment). Note that in all cases, both the target and the imported sequence must be nucleotide sequences. The alignment between your original sequence and the
imported sequence can be viewed in a separate window. You can then
choose to merge the 5' or 3' end of the imported sequence with the
target sequence in the record, or replace the target sequence with
the imported sequence. The features on the imported sequence will
be automatically copied to the original sequence. You can also
choose only to propagate features from the imported sequence record
to the target.
- Contact information for future submissions
The contact, authors, and affiliation information you provide on
the Submitting Authors form can now be saved as a block and used
for subsequent submissions. For your first Sequin submission, fill
in the requested information. Then, in the record viewer, click on
"Edit Submitter Info" under the Edit menu, and then on Export
Submitter Info under the File menu in the resulting Submission
Instructions form. For subsequent Sequin submissions, click on
Import Submitter Info on the first page of the Submitting Authors
form. You must still fill in the manuscript title on the this
page, though.
- Formatting segmented population/phylogenetic sets
Sequin can now read segmented sets of sequences which are parts of
phylogenetic, population, or mutation studies. A segmented set is a
collection of non-overlapping sequences which cover a specified
genetic region, such as a set of exons along with fragments of flanking
introns. The sequences must be in FASTA or FASTA+GAP format. Each
segment should have its own sequence identifier (the term immediately
following the ">", but organism name and source modifiers should only
be indicated for the first segment from each sequence. Square brackets
are used to delimit the members of a set. For example:
[ >bioseq1part1 [org=Mus musculus] [strain=BALB/c]
CAGATGGCTCC
>bioseq1part2 ATAATGACAGCTTCATAATGGCAGTGGGTGAGCCCCTGGTGCACATCAG
]
[
>bioseq2part1 [org=Rattus norvegicus] [strain=Sprague-Dawley]
CAGTCGGCTCC
>bioseq2part2
ATAATGATGTCTTCATAATGGCAGAAAGTGAGCCCCTGGTGCACATCAG
]
- Creating automatic definition lines
Sequin can now create definition lines (sequence titles)
automatically based on information provided in the record. This
option works for single sequences as well as sets of sequences, and
can handle complex annotations with multiple features. The
definition lines will follow standard GenBank conventions. Use the
function "Generate Definition Line" under the Sequin Annotate
menu.
- Encoding new information in definition line
If you are submitting the sequence for an organism which is not
present in the NCBI taxonomy database, you can indicate the lineage
of the organism on the first line (definition line) of your
FASTA-formatted nucleotide sequence. Use the modifier
[lineage=lineage] on the line where other modifiers are indicated.
For example,
>dna1 [org=Neworganism] [strain=A] [lineage=Newlineage]
GGGGGGGGGGAAAAAAAAAAAAAAATTTTTTTTTTTTTTTTCCCCCCCCCCCCCGGGGGGGGGGG
AAAAAAATTTTTTTTTTTTTCCCCCCCCCCCCCC
For information about the organisms presently in GenBank, see the
NCBI taxonomy browser at http://www.ncbi.nlm.nih.gov/Taxonomy/
Additional source information can also be encoded directly in the
definition line. You can now indicate
[location={genomic,chloroplast,kinetoplast,mitochondrion,macronuclear,
extrachromosomal,plasmid,transposon,insertion sequence,cyanelle,proviral, virion}] and [molecule={dna,rna}] . In
each case you can pick one item from the list in {}, so a sample
definition line could be:
>dna1 [org=Homo sapiens] [location=genomic] [molecule=dna]
- Direct submission information
The DIRECT SUBMISSION reference for your new submission will now
appear as it will once the record is released to the public. In
the past, this information was stored by Sequin, but not
displayed. This citation lists the authors who should receive
scientific credit for the sequence, and may have as many authors as
you see fit. It should have, at the very least, one author.
Author names are initially entered on the Submitting Authors form.
You can modify the list by double clicking on the reference.
- Minor changes
- Reference publication types now include Proceedings (meetings) and
Proceedings Chapter (meeting abstracts).
- When you highlight a range of sequence in the Sequence Editor, the
selected sequence is shown as a box in the Graphic view of the
record.
- An option called "Select Target" was added to the Sequin Search
menu. This option changes the sequence which is selected in the
Target Sequence pop-up.
Version 2.28--September 19, 1997
- You can now replace or merge the sequence in the record with a new sequence
without going into the Sequence Editor. In the main Sequin window, choose one
of the three items in the
Edit-->Update Sequence submenu. You can import a
sequence in FASTA format (Read FASTA File), a sequence record in ASN.1 format
(Read Sequence Record), or, if you are running Sequin in its Network Aware
mode, download a sequence record from Entrez (Download Accession).
The alignment
between your original sequence and the imported sequence can be viewed in a separate
window. You can then choose to merge the 5' or 3' end of the imported
sequence with the target sequence in the record, or replace the target
sequence with the imported sequence. The features on the imported sequence
will be automatically copied to the original sequence. You can also choose
only to propagate features from the imported sequence record to the target.
- If you are submitting an aligned set of sequences, and one or more of the sequences
is already present in the GenBank/EMBL/DDBJ database, you can mark that
sequence(s) so that it does not get a new accession number. Instead of
providing the sequence(s) with a new Sequence Identifier, add 'acc' to the
existing accession or gi number. For instance, use the identifier accU12345, where
U12345 is the existing accession number. The sequence does not need a
title since it is not being resubmitted to the database. Thus, an example of a nucleotide definition line would be:
>accU54469
- You can now encode a a comment in a protein definition line, and the text of
the comment will turn into a /note on the CDS feature. For example, if the
definition line for the protein sequence is
>aa1 [gene=eIF4E] [prot=eukaryotic initiation factor 4E-I] [comment=alternative splice product] Drosophila melanogaster eukaryotic initiation factor 4E-I, complete sequence
the corresponding CDS feature will have the following fields:
/gene="eIF4E"
/note="alternative splice product"
/product="eukaryotic initiation factor 4E-I"
- PowerBLAST capabilities have been enhanced. From within Sequin, you can
perform blastn or tblastn searches of the sequence(s) in the record against
many NCBI supported nucleotide databases, and blastp or blastx searches
against protein databases. PowerBLAST can now also handle large sequences.
For additional information, see the BLAST home page at
http://www.ncbi.nlm.nih.gov/BLAST/.
- A variety of minor bugs have been fixed (affecting all platforms).
Version 2.20--July 29, 1997
- In the Sequence Editor, the "Find" command under the Edit menu now searches the displayed nucleotide sequence for amino acid as well as nucleotide sequence patterns. If you type in an amino acid sequence, Sequin will search for that sequence in a three-frame translation of the nucleotide sequence.
For example,
- CDLPEYC finds DNA sequences encoding CDLPEYC
- [CRQ]DLPEYC finds DNA sequences encoding C or R or Q followed by DLPEYC
- XDLPEYC finds DNA sequences encoding any amino acid followed by DLPEYC
- CDL(3)EYC finds DNA sequences encoding CDLEEEYC
- CDL(1:3)PE finds DNA sequences encoding CDLPE, CDLPPE, and CDLPPPE
- CDL(1:3)XE finds DNA sequences encoding CDL, followed by 1-3 occurrences of
any amino acid, followed by E, i.e., CDLAAE, CDLRSE, or CDLAPQE
- For gene features on a segmented set, the location is now specified by an "order" rather than a "join". In the past, a gene feature on a segmented set was indicated on the last record in the set as follows:
gene join(AF000001:1..2000,1..5388)
/gene="testbar"
In this version of Sequin, the location of the gene feature is shown on the last record as follows:
gene order(AF000001:1..2000,1..5388)
/gene="testbar"
- The order in which the gene, CDS, and other features are displayed has been changed. In the past, the order of these features, if they covered the same sequence interval, was random. Now, features with the same interval are always displayed in the following order:
gene
CDS
any_feature
Please note that, as always, the order in which features are displayed depends on their left-most sequence position. Thus, the source feature, whose left-most position is "1", is always the first feature. For example,
source 1..4495
/organism="Homo sapiens"
gene 86..4339
/gene="ABC1"
CDS 86..4339
/gene="ABC1"
- Under the Sequin Search menu, the command previously called "Find" has been renamed "Find ASN.1". This command allows you to find and replace strings of text in your submission.
- Under the Sequin Search menu, a new command called "Find FlatFile" has been added. This command allows you to find strings of text in your submission.
- Under the Sequin Annotate menu, an additional choice called "Remaining Features" has been added. Now any feature which is legal under the DDBJ/EMBL/GenBank feature table can be added to a submission.
- The default HUP date is now one year from the current date. The HUP (hold until published date) is the date on which you specify that the sequence can be released to the public.
- In the Sequence Editor, the "Label" option is now available under the View menu. This option allows you to choose how sequence names are displayed in an alignment.
- A number of bugs in the Sequence Editor have been fixed.
- A number of bugs specific to the DEC Alpha OSF1 version of Sequin have been fixed.
Version 2.14--July 5, 1997
- Network Entrez, an NCBI tool for accessing bibliographic, sequence, and
structure records is now fully integrated into Sequin. As before, users
can download sequences from Entrez to view or to edit and resubmit to the
databases. Now, users can also view any type of record on demand from within
Sequin. Users are reminded that they can only update their own records this
way.
- PowerBLAST, a version of the client for the popular BLAST software
for sequence comparisons, is now available from within Sequin. Users
can compare their sequence to sequences in the nucleotide and protein
databases and view the from results within Sequin.
- A new algorithm is now used to calculate global sequence alignments.
You can have Sequin calculate and display the alignment between a
sequence in the record and another sequence in a file. In the sequence
editor, select the option "Align with" under the Edit menu.
- Sequin will now recognize sequence alignments which have been saved in one of two NEXUS formats, NEXUS Interleaved and NEXUS Contiguous formats.
- Records can now be viewed with two new Display Formats, Summary and Sequence.
Summary format shows the range of any sequence alignments in the record.
Sequence format shows the sequence(s) in the record along with any
associated features.
- The location of certain menu items has been changed. All features
and descriptors are now accessed from the Annotate menu.
- A variety of minor bugs have been fixed (affecting all platforms).
Version 1.94--March 12, 1997
- We have increased support for phylogenetic/population study
submissions. The supporting documentation has been extended and now
includes instructions on how to propagate features (such as CDS or
rRNA) through alignments.
- We have added pattern matching for nucleotide sequences using regular expressions. This is used via the "Find" command in the Sequence Editor Edit menu.
For example,
- TCAGGGC finds the sequence TCAGGGC
- [TCA]CAGGGC finds T or C or A followed by CAGGGC
- NCAGGGC finds T or C or G or A followed by CAGGGC
- TCA(3)GC finds the sequence TCAGGGC
- TCA(1:3)GC finds the sequences TCAGC, TCAGGC, and TCAGGGC
- TCA(1:3)NC finds the sequence TCA, followed by 1-3 occurrences of
G,A,T,or C, followed by C, i.e., TCATC or TCATTC or TCAATGC
- You must now enter the scientific, not the common, organism name when
preparing a new submission. Sequin, as well as the GenBank/EMBL/DDBJ
record, will still list both scientific and common names, however.
- A variety of minor bugs have been fixed (affecting all platforms).
Questions or Comments?
Write to the NCBI Service Desk
Revised June 10, 2004