Web Server Statistics for USGS The Water Cycle
In most of the reports below, 'reqs' are requests, which include all files needed to display a web page (images, style sheets, etc.) in addition to the page itself. For this reason there will be more reqs than pages. However, in the "Request Report," only those items counted as a page are included.
For an explanation of the results on this page, visit the Analog site.
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report contains overall statistics.
Successful requests: 79,669
Average successful requests per day: 4,536
Successful requests for pages: 79,669
Average successful requests for pages per day: 4,536
Distinct files requested: 168
Distinct hosts served: 17,292
Data transferred: 1.307 gigabytes
Average data transferred per day: 76.260 megabytes
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the activity in each month.
Each unit (
) represents 2,000
requests for pages or part thereof.
month: #reqs: #pages: --------: -----: ------: Sep 2004: 18051: 18051:Busiest month: Oct 2004 (61,618 requests for pages).Oct 2004: 61618: 61618:
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the activity in each week.
Each unit () represents 1,000
requests for pages or part thereof.
week beg.: #reqs: #pages: ---------: -----: ------: Sep/26/04: 19791: 19791:Busiest week: week beginning Oct/ 3/04 (31,342 requests for pages).Oct/ 3/04: 31342: 31342:
Oct/10/04: 28536: 28536:
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the total activity for each day of the week, summed over all the weeks in the report.
Each unit () represents 500 requests
for pages or part thereof.
day: #reqs: #pages: ---: -----: ------: Sun: 4404: 4404:Fri: 5054: 5054:
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the total activity for each hour of the day, summed over all the days in the report.
Each unit () represents 150 requests
for pages or part thereof.
hour: #reqs: #pages: ----: -----: ------: 0: 1634: 1634:
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the countries of the computers which requested files.
Listing domains, sorted by the amount of traffic.
#reqs: %bytes: domain
-----: ------: ------
24436: 30.31%: [unresolved numerical addresses]
21505: 28.27%: .net (Networks)
12686: 16.53%: .com (Commercial)
6015: 7.12%: .us (United States)
2125: 2.90%: .edu (US Higher Education)
1986: 2.69%: .org (Non Profit Making Organizations)
1525: 1.74%: .ca (Canada)
1294: 1.70%: .au (Australia)
1076: 1.43%: .arpa (Arpanet)
1057: 1.41%: .gov (US Government)
599: 0.79%: .uk (United Kingdom)
961: 0.45%: .mx (Mexico)
215: 0.38%: .sg (Singapore)
231: 0.30%: .nz (New Zealand)
141: 0.23%: .za (South Africa)
437: 0.22%: .fr (France)
258: 0.20%: .br (Brazil)
171: 0.20%: .it (Italy)
107: 0.19%: .in (India)
107: 0.17%: .tt (Trinidad and Tobago)
139: 0.16%: .ph (Philippines)
109: 0.16%: .pl (Poland)
105: 0.15%: .mil (US Military)
138: 0.14%: .nl (Netherlands)
104: 0.13%: .jp (Japan)
79: 0.13%: .sa (Saudi Arabia)
259: 0.12%: .se (Sweden)
98: 0.12%: .co (Colombia)
112: 0.11%: .de (Germany)
100: 0.10%: .ar (Argentina)
64: 0.09%: .id (Indonesia)
55: 0.07%: [domain not given]
91: 0.07%: .be (Belgium)
92: 0.07%: .pt (Portugal)
71: 0.07%: .at (Austria)
154: 0.07%: .pe (Peru)
82: 0.06%: .ch (Switzerland)
67: 0.06%: .es (Spain)
31: 0.06%: .cy (Cyprus)
39: 0.06%: .th (Thailand)
98: 0.05%: .cl (Chile)
31: 0.05%: .dk (Denmark)
48: 0.04%: .no (Norway)
40: 0.04%: .il (Israel)
29: 0.04%: .qa (Qatar)
39: 0.04%: .hu (Hungary)
37: 0.04%: .cz (Czech Republic)
23: 0.03%: .jo (Jordan)
16: 0.03%: .ni (Nicaragua)
26: 0.03%: .ee (Estonia)
18: 0.03%: .gr (Greece)
14: 0.03%: .pg (Papua New Guinea)
15: 0.02%: .my (Malaysia)
12: 0.02%: .tr (Turkey)
19: 0.02%: .ma (Morocco)
10: 0.02%: .eg (Egypt)
11: 0.02%: .is (Iceland)
13: 0.02%: .om (Oman)
11: 0.02%: .mm (Myanmar)
15: 0.01%: .uy (Uruguay)
16: 0.01%: .ro (Romania)
7: 0.01%: .mu (Mauritius)
8: 0.01%: .sk (Slovakia)
18: 0.01%: .fi (Finland)
20: 0.01%: .do (Dominican Republic)
6: 0.01%: .lb (Lebanon)
13: 0.01%: .hr (Croatia)
8: 0.01%: .hk (Hong Kong)
3: 0.01%: .bt (Bhutan)
3: 0.01%: .bw (Botswana)
8: 0.01%: .pk (Pakistan)
6: 0.01%: .tw (Taiwan)
6: 0.01%: .tz (Tanzania)
2: 0.01%: .fj (Fiji)
2: 0.01%: .biz (Businesses)
5: 0.01%: .ke (Kenya)
2: 0.01%: .bn (Brunei Darussalam)
6: 0.01%: .bg (Bulgaria)
5: 0.01%: .si (Slovenia)
5: : .ae (United Arab Emirates)
8: : .bs (Bahamas)
6: : [unknown domain]
8: : .gt (Guatemala)
4: : .dm (Dominica)
4: : .ms (Montserrat)
2: : .lt (Lithuania)
2: : .ie (Ireland)
2: : .np (Nepal)
5: : .lu (Luxembourg)
3: : .yu (Yugoslavia)
4: : .na (Namibia)
2: : .kh (Cambodia)
1: : .mt (Malta)
1: : .bm (Bermuda)
1: : .vi (Virgin Islands (USA))
1: : .cc (Cocos (Keeling) Islands)
1: : .ru (Russia)
1: : .cn (China)
1: : .int (International Treaty Organizations)
1: : .ws (Samoa)
3: : .sv (El Salvador)
3: : .py (Paraguay)
2: : .nu (Niue)
2: : .cr (Costa Rica)
2: : .mz (Mozambique)
1: : .tv (Tuvalu)
1: : .uz (Uzbekistan)
1: : .nc (New Caledonia)
1: : .ec (Ecuador)
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the referrers (where people followed links from, or pages which included this site's images).
Listing the top 50 referring URLs by the number of requests, sorted by the number of requests.
#reqs: URL -----: --- 26605: http://ga.water.usgs.gov/edu/watercycle.html 5399: http://www.google.com/search 291: http://www.google.com/search?hl=en&q=water+cycle 223: http://www.google.com/search?hl=en&ie=UTF-8&q=water+cycle 146: http://www.google.com/search?hl=en&q=water+cycle&btnG=Google+Search 130: http://www.google.com/search?hl=en&ie=ISO-8859-1&q=water+cycle 114: http://www.google.com/search?sourceid=navclient&ie=UTF-8&q=water+cycle 95: http://www.google.com/search?hl=en&ie=UTF-8&q=water+cycle&btnG=Google+Search 90: http://www.google.com/search?hl=en&q=the+water+cycle 72: http://www.google.com/search?hl=en&lr=&q=water+cycle 64: http://www.google.com/search?hl=en&lr=&ie=UTF-8&q=water+cycle 58: http://www.google.com/search?hl=en&ie=UTF-8&q=the+water+cycle 53: http://www.google.com/search?hl=en&ie=ISO-8859-1&q=water+cycle&btnG=Google+Search 1793: http://ga.water.usgs.gov/edu/ 1686: http://ga.water.usgs.gov/edu/mearth.html 1133: http://ga.water.usgs.gov/edu/watercyclehi.html 1065: http://ga.water.usgs.gov/edu/watercyclesummary.html 816: http://ga.water.usgs.gov/edu/watercyclecondensation.html 763: http://images.google.com.mx/imgres 712: http://ga.water.usgs.gov/edu/watercycleevaporation.html 621: http://www.google.ca/search 56: http://www.google.ca/search?hl=en&ie=UTF-8&q=water+cycle&meta= 55: http://www.google.ca/search?hl=en&q=water+cycle&meta= 571: http://ga.water.usgs.gov/edu/index.html 557: http://ga.water.usgs.gov/edu/earthwherewater.html 535: http://ga.water.usgs.gov/edu/watercycleprecipitation.html 527: http://ga.water.usgs.gov/edu/followdrip.html 520: http://ga.water.usgs.gov/edu/watercycletranspiration.html 446: http://images.google.fr/imgres 435: http://images.google.com/imgres 412: http://ga.water.usgs.gov/edu/watercyclerunoff.html 384: http://ga.water.usgs.gov/edu/waterproperties.html 363: http://ga.water.usgs.gov/edu/watercycleice.html 343: http://www.google.com.au/search 340: http://ga.water.usgs.gov/edu/watercycleoceans.html 318: http://ga.water.usgs.gov/edu/watercyclegwstorage.html 314: http://ga.water.usgs.gov/edu/watercycleatmosphere.html 291: http://ga.water.usgs.gov/edu/mearthall.html 291: http://ga.water.usgs.gov/edu/earthhowmuch.html 289: http://www.google.co.uk/search 284: http://ga.water.usgs.gov/edu/watercyclesummarytext.html 276: http://search.yahoo.com/search 274: http://ga.water.usgs.gov/edu/watercycleinfiltration.html 270: http://aolsearch.aol.com/aol/search 266: http://ga.water.usgs.gov/edu/watercyclefreshstorage.html 263: http://ga.water.usgs.gov/edu/watercyclesnowmelt.html 251: http://images.google.se/imgres 54: http://images.google.se/imgres?imgurl=http://ga.water.usgs.gov/edu/graphics/watercycleswedishhigh.jpg&imgrefurl=http://ga.water.usgs.gov/edu/watercyclegraphicswedishhi.html&h=526&w=756&sz=147&tbnid=2QZd86H5b-4J:&tbnh=97&tbnw=139&start=1&prev=/images%3Fq%3Dvattnets+kretslopp%26hl%3Dsv%26lr%3D 243: http://ga.water.usgs.gov/edu/watercyclesmallerdiagrams.html 226: http://ga.water.usgs.gov/edu/watercyclegwdischarge.html 221: http://ga.water.usgs.gov/edu/watercyclestreamflow.html 201: http://web.ask.com/redir 171: http://images.google.cl/imgres 168: http://ga.water.usgs.gov/edu/dictionary.html 166: http://ga.water.usgs.gov/edu/watercyclesprings.html 166: http://images.google.com.br/imgres 166: http://images.google.es/imgres 161: http://images.google.com.pe/imgres 153: http://ga.water.usgs.gov/edu/watercycleguess.html 122: http://images.google.de/imgres 116: http://images.google.ca/imgres 113: http://www.google.com.ph/search 105: http://search.msn.com/results.aspx 101: http://search.usgs.gov/query.html 5865: [not listed: 1,390 URLs]
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists which queries people used in search engines to find the site.
Listing the top 30 queries by the number of requests, sorted by the number of requests.
#reqs: search term -----: ----------- 2632: water cycle 772: the water cycle 513: water cycle diagram 204: watercycle 132: ciclo del agua 112: diagram of the water cycle 111: vattnets kretslopp 104: picture of the water cycle 94: diagram of water cycle 86: water cycles 79: hydrologic cycle 78: diagram water cycle 77: water cycle picture 55: cycle of water 53: water 47: water cycle terms 44: water cycle pictures 40: picture of water cycle 35: a picture of the water cycle 35: usgs water cycle 34: water picture 30: the water cycle diagram 27: water cycle diagrams 24: evaporation 24: cycle de l'eau 22: picture of water 21: a diagram of the water cycle 19: ciclo da água 19: surface runoff 17: what is the water cycle 2704: [not listed: 1,733 search terms]
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists which words people used in search engines to find the site.
Listing the top 30 query words by the number of requests, sorted by the number of requests.
#reqs: search term -----: ----------- 6509: water 5744: cycle 1068: diagram 516: picture 230: watercycle 207: ciclo 187: agua 162: del 155: evaporation 127: kretslopp 124: hydrologic 114: de 113: vattnets 111: cycles 103: transpiration 93: science 92: pictures 88: l'eau 87: condensation 87: runoff 87: surface 81: amount 80: earth 75: diagrams 65: drop 62: infiltration 60: air 58: usgs 57: precipitation 55: percentage 4903: [not listed: 1,066 search terms]
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the vendors of visitors' browsers.
Listing the top 20 browsers by the number of requests for pages, sorted by the number of requests for pages.
#: #reqs: #pages: browser --: -----: ------: ------- 1: 70589: 70589: MSIE : 58117: 58117: MSIE/6 : 58058: 58058: MSIE/6.0 : 59: 59: MSIE/6.0b : 12285: 12285: MSIE/5 : 3947: 3947: MSIE/5.5 : 2670: 2670: MSIE/5.0 : 1511: 1511: MSIE/5.01 : 1255: 1255: MSIE/5.17 : 969: 969: MSIE/5.23 : 690: 690: MSIE/5.16 : 578: 578: MSIE/5.22 : 224: 224: MSIE/5.13 : 187: 187: MSIE/5.21 : 118: 118: MSIE/5.15 : 178: 178: MSIE/4 : 90: 90: MSIE/4.01 : 88: 88: MSIE/4.5 : 9: 9: MSIE/3 : 8: 8: MSIE/3.01 : 1: 1: MSIE/3.02 2: 4276: 4276: Mozilla : 2976: 2976: Mozilla/1 : 985: 985: Mozilla/1.4 : 402: 402: Mozilla/1.7 : 327: 327: Mozilla/1.6 : 323: 323: Mozilla/1.7.3 : 308: 308: Mozilla/1.7.2 : 307: 307: Mozilla/1.0.2 : 202: 202: Mozilla/1.0.1 : 38: 38: Mozilla/1.7b : 35: 35: Mozilla/1.7.1 : 28: 28: Mozilla/1.5 : 38: 38: Mozilla/0 : 38: 38: Mozilla/0.9.4.2 3: 1974: 1974: Netscape (compatible) 4: 977: 977: Googlebot : 977: 977: Googlebot/2 5: 816: 816: Netscape : 718: 718: Netscape/4 : 182: 182: Netscape/4.79 : 91: 91: Netscape/4.77 : 87: 87: Netscape/4.8 : 46: 46: Netscape/4.76 : 46: 46: Netscape/4.7 : 43: 43: Netscape/4.73C-CCK-MCD : 38: 38: Netscape/4.72 : 33: 33: Netscape/4.77C-CCK-MCD : 22: 22: Netscape/4.5 : 20: 20: Netscape/4.78 : 82: 82: Netscape/6 : 23: 23: Netscape/6.2.3 : 21: 21: Netscape/6.2.1 : 14: 14: Netscape/6.2 : 11: 11: Netscape/6.0 : 10: 10: Netscape/6.2.2 : 3: 3: Netscape/6.1 : 1: 1: Netscape/1 : 1: 1: Netscape/1.0 : 1: 1: Netscape/3 : 1: 1: Netscape/3.0 6: 163: 163: Ultraseek 7: 99: 99: msnbot : 99: 99: msnbot/0 8: 98: 98: Eco-Portal Spider - http: : 98: 98: Eco-Portal Spider - http://www 9: 98: 98: Opera : 94: 94: Opera/7 : 4: 4: Opera/6 10: 80: 80: FirstGov.gov Search - POC:firstgov.webmasters@gsa.gov 11: 49: 49: Teleport Pro : 49: 49: Teleport Pro/1 12: 42: 42: SURF 13: 26: 26: WebTrends Link Analyzer 14: 24: 24: Scooter : 24: 24: Scooter/3 15: 21: 21: Konqueror : 20: 20: Konqueror/3 : 1: 1: Konqueror/2 16: 17: 17: LinkCheck : 17: 17: LinkCheck/0 17: 14: 14: Java1.4.0 18: 13: 13: MSProxy : 13: 13: MSProxy/2 19: 13: 13: Rational SiteCheck (Windows NT) 20: 13: 13: webcollage : 13: 13: webcollage/1 : 130: 130: [not listed: 53 browsers]
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the sizes of files.
size: #reqs: %bytes:
----------: -----: ------:
0: 55: :
1b- 10b: 24: :
11b- 100b: 0: :
101b- 1kb: 401: 0.01%:
1kb- 10kb: 22434: 7.15%:
10kb-100kb: 56755: 92.84%:
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the extensions of requested files.
Listing extensions with at least 1 byte of traffic, sorted by the amount of traffic.
#reqs: %bytes: extension -----: ------: --------- 79669: 100%: .html [Hypertext Markup Language]
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
This report lists the files on the site.
Listing files, sorted by the number of requests.
#reqs: %bytes: last time: file
-----: ------: ------------------: ----
30843: 43.40%: Oct/14/04 11:58 PM: /edu/watercycle.html
3565: 1.18%: Oct/14/04 11:51 PM: /edu/watercyclehi.html
3264: 4.92%: Oct/14/04 11:50 PM: /edu/watercyclecondensation.html
3188: 16.98%: Oct/14/04 11:53 PM: /edu/watercyclesummary.html
2749: 3.22%: Oct/14/04 11:54 PM: /edu/watercycleevaporation.html
2070: 0.67%: Oct/14/04 11:52 PM: /edu/watercyclegraphichi.html
2027: 2.70%: Oct/14/04 11:50 PM: /edu/watercycleprecipitation.html
1733: 0.17%: Oct/14/04 11:51 PM: /edu/watercycleprint.html
1697: 1.76%: Oct/14/04 11:50 PM: /edu/watercycletranspiration.html
1525: 0.50%: Oct/14/04 11:36 PM: /edu/watercyclegraphicspanishhi.html
1486: 1.90%: Oct/14/04 11:55 PM: /edu/watercyclerunoff.html
1410: 1.70%: Oct/14/04 11:22 PM: /edu/watercycleoceans.html
1308: 1.59%: Oct/14/04 11:53 PM: /edu/watercycleice.html
1163: 1.56%: Oct/14/04 11:57 PM: /edu/watercyclegwstorage.html
1158: 1.52%: Oct/14/04 11:53 PM: /edu/watercyclefreshstorage.html
1103: 1.22%: Oct/14/04 11:50 PM: /edu/watercycleatmosphere.html
1075: 0.11%: Oct/14/04 11:43 PM: /edu/watercycleprintnotext.html
1008: 1.23%: Oct/14/04 11:04 PM: /edu/watercycleinfiltration.html
976: 1.35%: Oct/14/04 10:41 PM: /edu/watercyclegwdischarge.html
927: 4.45%: Oct/14/04 11:10 PM: /edu/watercyclesummarytext.html
847: 0.91%: Oct/14/04 11:51 PM: /edu/watercyclesnowmelt.html
805: 0.26%: Oct/14/04 11:53 PM: /edu/watercyclegraphicportuguesehi.html
775: 0.28%: Oct/14/04 11:57 PM: /edu/watercyclespanishhi.html
745: 1.24%: Oct/14/04 11:05 PM: /edu/watercyclestreamflow.html
680: 0.31%: Oct/14/04 11:09 PM: /edu/watercycleguess.html
657: 0.22%: Oct/14/04 8:04 PM: /edu/watercyclegraphicfrenchhi.html
635: 0.77%: Oct/14/04 11:51 PM: /edu/watercyclesprings.html
514: 0.18%: Oct/14/04 9:52 PM: /edu/watercyclechinesehi.html
507: 0.18%: Oct/14/04 9:52 PM: /edu/watercyclearabichi.html
445: 0.24%: Oct/14/04 10:12 PM: /edu/watercycle2ndgrade.html
441: 0.15%: Oct/14/04 9:14 PM: /edu/watercyclegraphicswedishhi.html
418: 0.01%: Oct/14/04 10:37 PM: /edu/watercyclegraphic.html
361: 0.13%: Oct/14/04 11:53 PM: /edu/watercyclefrenchhi.html
326: 0.10%: Oct/14/04 9:38 PM: /edu/watercyclegraphiclo.html
309: 0.11%: Oct/14/04 11:51 PM: /edu/watercyclejapanesehi.html
299: 0.11%: Oct/14/04 9:59 PM: /edu/watercycleitalianhi.html
279: 0.11%: Oct/14/04 11:43 PM: /edu/watercyclehebrewhi.html
278: 0.10%: Oct/14/04 11:49 PM: /edu/watercyclegermanhi.html
269: 0.10%: Oct/14/04 10:14 PM: /edu/watercyclegreekhi.html
240: 0.32%: Oct/14/04 11:19 PM: /edu/watercyclesmallerdiagrams.html
233: 0.08%: Oct/14/04 11:48 PM: /edu/watercyclerussianhi.html
215: 0.08%: Oct/14/04 11:42 PM: /edu/watercyclepolishhi.html
212: 0.07%: Oct/14/04 11:48 PM: /edu/watercycledutchhi.html
198: 0.07%: Oct/14/04 9:54 PM: /edu/watercyclethaihi.html
189: 0.06%: Oct/14/04 11:53 PM: /edu/watercyclebulgarianhi.html
180: 0.06%: Oct/14/04 11:25 PM: /edu/watercycleczechhi.html
173: 0.06%: Oct/14/04 11:55 PM: /edu/watercycleportuguesehi.html
164: 0.06%: Oct/14/04 11:40 PM: /edu/watercycleturkishhi.html
160: 0.06%: Oct/14/04 11:51 PM: /edu/watercycleswedishhi.html
153: 0.06%: Oct/14/04 10:40 PM: /edu/watercycleukrainianhi.html
149: 0.05%: Oct/14/04 9:53 PM: /edu/watercyclekannadahi.html
141: 0.05%: Oct/14/04 11:18 PM: /edu/watercyclecroatianhi.html
139: 0.04%: Oct/14/04 10:09 PM: /edu/watercyclegraphicchinesehi.html
138: 0.05%: Oct/14/04 11:54 PM: /edu/watercyclenepalihi.html
138: 0.05%: Oct/14/04 11:51 PM: /edu/watercyclefinnishhi.html
136: 0.05%: Oct/14/04 11:53 PM: /edu/watercycledanishhi.html
135: 0.05%: Oct/14/04 11:51 PM: /edu/watercycletamilhi.html
131: 0.05%: Oct/14/04 11:55 PM: /edu/watercyclenorwegianhi.html
126: 0.05%: Oct/14/04 9:53 PM: /edu/watercyclehiligaynonhi.html
124: 0.05%: Oct/14/04 9:53 PM: /edu/watercyclehungarianhi.html
121: 0.04%: Oct/14/04 11:51 PM: /edu/watercycleromanianhi.html
119: 0.04%: Oct/14/04 3:05 PM: /edu/watercyclegraphicgermanlo.html
118: 0.04%: Oct/14/04 11:42 PM: /edu/watercyclemalayalamhi.html
111: 0.04%: Oct/14/04 11:53 PM: /edu/watercyclemalaysianhi.html
111: 0.04%: Oct/14/04 11:10 PM: /edu/watercycleestonianhi.html
107: 0.04%: Oct/14/04 11:55 PM: /edu/watercyclelatvianhi.html
98: 0.04%: Oct/14/04 9:53 PM: /edu/watercyclelithuanianhi.html
94: 0.03%: Oct/14/04 9:53 PM: /edu/watercycleslovakianhi.html
91: 0.03%: Oct/14/04 9:51 AM: /edu/watercyclegraphiclithuanianhi.html
87: 0.03%: Oct/14/04 5:13 AM: /edu/watercyclegraphicfrenchlo.html
84: 0.03%: Oct/14/04 12:01 PM: /edu/watercyclegraphicitalianhi.html
78: 0.03%: Oct/14/04 11:09 PM: /edu/watercycleslovenehi.html
52: 0.02%: Oct/14/04 1:13 PM: /edu/watercyclegraphicgermanhi.html
50: 0.02%: Oct/14/04 9:54 PM: /edu/watercyclewolofhi.html
48: 0.01%: Oct/13/04 10:47 PM: /edu/watercyclegraphicchineselo.html
45: 0.01%: Oct/13/04 11:28 AM: /edu/watercyclegraphicspanishlo.html
33: 0.01%: Oct/13/04 8:25 PM: /edu/watercyclegraphicrussianhi.html
32: 0.01%: Oct/13/04 9:53 PM: /edu/watercyclegraphicgreekhi.html
31: 0.01%: Oct/13/04 10:20 PM: /edu/watercyclegraphicmalaysianhi.html
29: 0.01%: Oct/14/04 9:55 PM: /edu/watercyclelo.html
28: 0.11%: Oct/14/04 9:09 AM: /edu/watercyclesummarytotranslate.html
26: 0.01%: Oct/14/04 6:23 AM: /edu/watercyclegraphicarabichi.html
23: 0.01%: Oct/10/04 2:45 AM: /edu/watercyclegraphichungarianhi.html
22: 0.01%: Oct/13/04 5:59 PM: /edu/watercyclegraphickannadahi.html
21: 0.01%: Oct/14/04 8:50 PM: /edu/watercyclegraphicdutchhi.html
19: 0.01%: Oct/13/04 9:03 AM: /edu/watercyclegraphicpolishhi.html
19: 0.01%: Oct/14/04 7:36 PM: /edu/watercyclelores.html
18: 0.01%: Oct/14/04 8:23 AM: /edu/watercyclegraphicthaihi.html
16: : Oct/14/04 5:25 AM: /edu/watercyclegraphichebrewlo.html
16: : Oct/14/04 3:06 AM: /edu/watercyclegraphicswedishlo.html
16: 0.01%: Oct/14/04 5:43 PM: /edu/watercyclegraphicnepalihi.html
15: : Oct/12/04 8:47 PM: /edu/watercyclegraphicrussianlo.html
13: : Oct/14/04 9:55 PM: /edu/watercyclebulgarianlo.html
12: : Oct/14/04 9:55 PM: /edu/watercycleportugueselo.html
12: : Oct/14/04 9:55 PM: /edu/watercyclechineselo.html
12: : Oct/14/04 9:55 PM: /edu/watercyclemalaysianlo.html
12: : Oct/12/04 2:59 PM: /edu/watercyclegraphicmalayalamhi.html
12: : Oct/13/04 10:59 PM: /edu/watercyclegraphicnorwegianhi.html
11: : Oct/14/04 9:55 PM: /edu/watercyclefrenchlo.html
11: : Oct/14/04 9:55 PM: /edu/watercycleitalianlo.html
11: : Oct/14/04 5:56 AM: /edu/watercyclegraphicgreeklo.html
11: : Oct/14/04 9:55 PM: /edu/watercyclegermanlo.html
11: : Oct/14/04 9:55 PM: /edu/watercycleestonianlo.html
11: : Oct/14/04 9:55 PM: /edu/watercyclefinnishlo.html
11: : Oct/14/04 9:55 PM: /edu/watercycledanishlo.html
11: : Oct/14/04 9:55 PM: /edu/watercyclethailo.html
11: : Oct/14/04 9:55 PM: /edu/watercyclepolishlo.html
11: : Oct/14/04 11:55 AM: /edu/watercyclegraphicromanianhi.html
11: : Oct/14/04 9:55 PM: /edu/watercycledutchlo.html
10: : Oct/11/04 12:54 AM: /edu/watercyclegraphichebrewhi.html
10: : Oct/14/04 9:55 PM: /edu/watercycleczechlo.html
10: : Oct/14/04 9:55 PM: /edu/watercycletamillo.html
10: : Oct/14/04 9:55 PM: /edu/watercyclearabiclo.html
10: : Oct/14/04 9:55 PM: /edu/watercyclehebrewlo.html
10: : Oct/14/04 7:26 PM: /edu/watercyclegraphicportugueselo.html
10: : Oct/ 8/04 6:45 AM: /edu/watercyclegraphiclithuanianlo.html
9: : Oct/14/04 9:55 PM: /edu/watercycleswedishlo.html
9: : Oct/13/04 7:39 PM: /edu/watercyclegraphicarabiclo.html
9: : Oct/14/04 9:55 PM: /edu/watercycleslovenelo.html
9: : Oct/14/04 9:55 PM: /edu/watercyclegreeklo.html
9: : Oct/14/04 5:43 PM: /edu/watercyclegraphictamilhi.html
9: : Oct/14/04 9:55 PM: /edu/watercyclerussianlo.html
9: : Oct/14/04 9:55 PM: /edu/watercycleturkishlo.html
9: : Oct/14/04 9:55 PM: /edu/watercyclespanishlo.html
8: : Oct/14/04 9:55 PM: /edu/watercyclelatvianlo.html
8: : Oct/14/04 9:55 PM: /edu/watercyclekannadalo.html
8: : Oct/14/04 9:55 PM: /edu/watercyclecroatianlo.html
8: : Oct/ 8/04 10:12 AM: /edu/watercyclegraphicestonianhi.html
8: : Oct/14/04 9:55 PM: /edu/watercyclenorwegianlo.html
8: : Oct/14/04 9:55 PM: /edu/watercyclejapaneselo.html
8: : Oct/14/04 9:55 PM: /edu/watercyclehiligaynonlo.html
8: : Oct/14/04 11:08 PM: /edu/watercyclegraphicrussian.html
8: : Oct/14/04 9:55 PM: /edu/watercycleukrainianlo.html
7: : Oct/14/04 7:35 AM: /edu/watercyclegraphichiligaynonhi.html
7: : Oct/14/04 9:55 PM: /edu/watercyclenepalilo.html
7: : Oct/12/04 3:03 PM: /edu/watercyclegraphicslovenehi.html
7: : Oct/14/04 9:55 PM: /edu/watercyclehungarianlo.html
7: : Oct/14/04 9:55 PM: /edu/watercycleromanianlo.html
7: : Oct/ 8/04 11:45 PM: /edu/watercyclegraphicnepalilo.html
6: : Oct/14/04 9:55 PM: /edu/watercycleslovakianlo.html
6: : Oct/ 7/04 7:41 AM: /edu/watercyclegraphicfinnishhi.html
5: : Oct/ 6/04 12:14 PM: /edu/watercyclegraphicdanishhi.html
5: : Oct/ 8/04 1:02 AM: /edu/watercyclegraphichungarianlo.html
5: : Oct/14/04 12:45 PM: /edu/watercyclegraphicdutchlo.html
5: : Oct/14/04 7:16 PM: /edu/watercyclegraphicczechhi.html
5: : Oct/ 8/04 11:23 PM: /edu/watercyclegraphicslovakianhi.html
4: : Oct/12/04 8:23 AM: /edu/watercyclegraphicukrainianhi.html
4: : Oct/11/04 4:22 PM: /edu/watercyclegraphicturkishhi.html
4: : Oct/13/04 8:26 PM: /edu/watercyclegraphiclatvianhi.html
4: : Oct/ 7/04 3:35 PM: /edu/watercyclegraphicpolishlo.html
4: : Oct/11/04 12:06 PM: /edu/watercyclegraphiclatvianlo.html
4: : Oct/12/04 2:53 PM: /edu/watercyclegraphicslovenelo.html
4: : Oct/ 9/04 10:07 PM: /edu/watercyclegraphickannadalo.html
4: : Sep/30/04 12:24 PM: /edu/watercyclegraphicthailo.html
4: : Oct/12/04 6:23 AM: /edu/watercyclegraphictamillo.html
3: : Sep/30/04 1:44 PM: /edu/watercyclegraphicslovakianlo.html
3: : Sep/30/04 2:20 PM: /edu/watercyclegraphiccroatianhi.html
3: : Oct/ 2/04 5:17 PM: /edu/watercyclegraphiccroatianlo.html
3: : Sep/30/04 1:13 PM: /edu/watercyclegraphicczechlo.html
3: : Oct/10/04 6:39 PM: /edu/watercyclegraphicromanianlo.html
2: : Sep/30/04 11:30 AM: /edu/watercyclegraphicnorwegianlo.html
2: : Sep/30/04 12:03 PM: /edu/watercyclegraphicukrainianlo.html
2: : Sep/30/04 10:25 AM: /edu/watercyclegraphicturkishlo.html
2: : Sep/30/04 1:30 PM: /edu/watercyclegraphicmalayalamlo.html
2: : Sep/30/04 11:40 AM: /edu/watercyclegraphicmalaysianlo.html
2: : Sep/30/04 1:39 PM: /edu/watercyclegraphicfinnishlo.html
1: : Oct/14/04 9:55 PM: /edu/watercyclewoloflo.html
1: : Oct/ 9/04 10:59 AM: /edu/watercyclegraphicspanish.html
(Go To: Top: General Summary: Monthly Report: Weekly Report: Daily Summary: Hourly Summary: Domain Report: Referrer Report: Search Query Report: Search Word Report: Browser Summary: File Size Report: File Type Report: Request Report)
For an explanation of the results on this page, visit the Analog site.
| USGS | Biology | Geology | Geography | Water |